CognyX AI

CognyX AI is an AI development and consulting tool that builds custom AI agents, chatbots, and automation pipelines. They deliver over 110 projects from India, offering free AI consultations.

Claim this tool

No Views Yet

At a glance

Pricing

Custom

Free tier

API

Yes

Skill level

Technical

About

What is CognyX AI?

CognyX AI is a results-driven AI development and consulting company based in Ahmedabad, India, specializing in custom AI solutions for businesses worldwide. They leverage Generative AI, machine learning, and deep domain expertise to create production-grade AI agents, GPT-5 powered chatbots, and end-to-end automation pipelines. With over 110 projects delivered across various industries like healthcare, finance, and retail, CognyX AI focuses on helping companies reduce costs, accelerate operations, and boost customer satisfaction. Their services include AI-driven customer support chatbots, AI agents & automation, voice & conversational AI, generative AI for content creation, predictive analytics, natural language processing, computer vision, and n8n workflow automation. They also offer comprehensive AI consulting and strategy services, guiding businesses from discovery to continuous optimization.

Best used for

Ideal for businesses and enterprises who need to integrate advanced AI solutions, automate customer support with chatbots, and streamline internal operations. Especially valuable for companies looking to leverage custom AI agents and generative AI for improved efficiency and innovation across various industries.

Common actions

develop AI agents

build AI chatbots

automate workflows

implement generative AI

consult on AI strategy

Capabilities

Key features

Custom AI agent development
GPT-5 chatbot development
Automation pipeline creation
Voice AI agents
Generative AI solutions
Predictive analytics
AI consulting

Target Audience

business ownersctosit managersproduct managers

Integrations

salesforcehubspotzendeskfreshdesksapwhatsappslackmicrosoft-teams+ 2 more

Pricing & Plans

Custom

Not publicly disclosed. Check cognyx.ai for current pricing.

FAQs

What is the typical cost for AI development with CognyX AI?

AI development costs vary based on project complexity. A basic chatbot or FAQ bot typically ranges from $5,000 to $15,000. More complex full-stack AI agent systems or custom LLM applications can cost between $15,000 and $60,000+. They offer flexible engagement models including fixed-scope, retainers, and dedicated AI pods.

How long does it take to develop a custom AI solution with CognyX AI?

A proof-of-concept or MVP usually takes 2 to 6 weeks. A production-ready AI system with integrations and security hardening typically requires 8 to 12 weeks. Enterprise-scale deployments with multi-region support can extend to 3 to 6 months, following a phased delivery approach.

Which industries does CognyX AI serve with its solutions?

CognyX AI serves a wide range of industries including healthcare, finance and banking, retail and ecommerce, manufacturing, logistics and supply chain, insurance, real estate, telecom, education, and hospitality. Their AI solutions are tailored to meet industry-specific compliance and workflow requirements.

Trending

Subcategories trending in Productivity & Business

Workflow Automation HR & Recruiting Document Management Legal & Compliance Team Collaboration Startup Tools

Trending

Explore

Browse AI tools by category

Content & Design Productivity & Business Coding & Development AI Agents & Automation Research & Education Wellness & Lifestyle Career Development Marketing & Growth Data & Analytics Customer Support & CX Finance E-commerce